PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000652584
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 370aa    MW: 41794.4 Da    PI: 7.3184
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000652584genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.21.6e-53101401129
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                    +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi evd++k+ePwdL++  ++ +  ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++
  MDP0000652584  10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIGEVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIH 104
                    69****************************.9***************952444443456************************************* PP

            NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     ++++ +g++ktLvfy+grap+g+ktdW+mheyrle
  MDP0000652584 105 LTSSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 140
                    **********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.05E-595163IPR003441NAC domain
PROSITE profilePS5100557.67610163IPR003441NAC domain
PfamPF023654.7E-2811139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 370 aa     Download sequence    Send to blast
MAAGNGQLTV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIGEVDLNKL EPWDLKEKCR  60
IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLTSSKR IGMRKTLVFY  120
TGRAPHGQKT DWIMHEYRLE DDNITADQVQ QEDGWVVCRV FKKKNHNKGY QPEFAHHQDH  180
QEHEHFTNMK ASGSHAPILL DHHDHHQQKQ NHHRLEGLYD YPSSFDHAGS MHLPQLFSPE  240
SAVAASSFVS PHNINLNTMD IECSQNLLRL TSTAAAAAAA ASGSCGLVQQ QERSFISGGD  300
WSFLDKLLAS HQNLDINHST SQTKCNPSSS TQQLSNSHDH DHVGTSSSTQ QRFPFQYLGC  360
GTDFLKFSK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-52716514167NO APICAL MERISTEM PROTEIN
1ut4_B4e-52716514167NO APICAL MERISTEM PROTEIN
1ut7_A4e-52716514167NO APICAL MERISTEM PROTEIN
1ut7_B4e-52716514167NO APICAL MERISTEM PROTEIN
4dul_A4e-52716514167NAC domain-containing protein 19
4dul_B4e-52716514167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008383226.10.0PREDICTED: protein SOMBRERO-like
RefseqXP_008383227.10.0PREDICTED: protein SOMBRERO-like
SwissprotQ9MA171e-128SMB_ARATH; Protein SOMBRERO
TrEMBLM5WZ810.0M5WZ81_PRUPE; Uncharacterized protein
STRINGVIT_19s0085g01210.t011e-166(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72043447
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79580.31e-118NAC family protein